PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 117aa    MW: 12724.3 Da    PI: 10.0259
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14108genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof97.78.2e-3156103249
    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49 
               ++++l+cprC st+tkfCyynnys++qPr++C++CrryWt+GG+lrnv
  EMT14108  56 QQAKLECPRCSSTDTKFCYYNNYSTTQPRHYCRTCRRYWTHGGTLRNV 103
               67899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-1856103IPR003851Zinc finger, Dof-type
PfamPF027015.0E-2858103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.86960114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MAPASASLLP AASSNAGTKR PFAAEASDAT ELPLALPQVQ ESAAGKKNGN GQSPQQQAKL  60
ECPRCSSTDT KFCYYNNYST TQPRHYCRTC RRYWTHGGTL RNVRNVNLSK GIVMRAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6873901e-137FJ687390.1 Triticum aestivum Dof transcription factor 4 (Dof4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140869.11e-30uncharacterized protein LOC100272945
SwissprotO244631e-24PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLN1R2U02e-83N1R2U0_AEGTA; Dof zinc finger protein PBF
STRINGMLOC_72873.16e-38(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.18e-26Dof family protein